PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008238212.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 324aa    MW: 36380.7 Da    PI: 6.734
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008238212.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.48e-191562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEde+l d+++ +G g+W++ ++  g++R++k+c++rw +yl
   XP_008238212.1 15 KGPWTTEEDEKLMDYIAIHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding50.54.8e-1668113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E+  +++++   G++ W++Ia +++ gRt++++k++w+++l
   XP_008238212.1  68 RGKFSEDEERVIINLHSVVGNK-WSKIATHLP-GRTDNEIKNYWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-24765IPR009057Homeodomain-like
PROSITE profilePS5129417.561062IPR017930Myb domain
SuperFamilySSF466892.88E-3112109IPR009057Homeodomain-like
SMARTSM007173.0E-141464IPR001005SANT/Myb domain
PfamPF002499.1E-171562IPR001005SANT/Myb domain
CDDcd001679.82E-111762No hitNo description
PROSITE profilePS5129427.82863117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2666117IPR009057Homeodomain-like
SMARTSM007171.0E-1567115IPR001005SANT/Myb domain
PfamPF002491.0E-1468113IPR001005SANT/Myb domain
CDDcd001671.78E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MGRSPSCDEQ SGLKKGPWTT EEDEKLMDYI AIHGHGSWRA LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSEDEERVII NLHSVVGNKW SKIATHLPGR TDNEIKNYWN THLRKKLLHM  120
GIDPNTHKPR TDLNHLLNLS QLLRAANVGQ MNMSSWDNSL SLRLQAGAAQ LAKMQLLQHL  180
CMQVVNSSNS AAAPPPPLPN IDMMSTFGYQ NLNQLGGQAN SLEGFEGHNN SNNNNNNIPT  240
FDNNMRSYYE DMLQTKNPFP ALVSASSGTS CNTNTNQMEN SISGDPAADC FSTHSPTTIF  300
EDWEKLMDDE TSESYWKDIL ESIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008238212.10.0PREDICTED: transcription factor MYB39
SwissprotQ8GWP05e-86MYB39_ARATH; Transcription factor MYB39
TrEMBLM5WRB40.0M5WRB4_PRUPE; Uncharacterized protein
STRINGGLYMA09G33870.11e-108(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.22e-84myb domain protein 9